{ { }, The Meraki MS390 is the most powerful access switch in the Meraki portfolio which combines the simplicity of cloud-managed IT with the power of innovative Cisco switching technology. "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "context" : "envParam:viewOrderSpec", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'ReOKdIXsf1jjg9mokC-7c1f5cQr6-ShTszAQmXXktWY. "useTruncatedSubject" : "true", }, "context" : "", "action" : "rerender" "actions" : [ ] { "disableKudosForAnonUser" : "false", "context" : "", "event" : "deleteMessage", } "actions" : [ "event" : "MessagesWidgetCommentForm", ","messageActionsSelector":"#messageActions_0","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_0","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); { { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:sortLabelsWidget","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#labelsTaplet","action":"sortLabelsWidget","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.labelstaplet:sortlabelswidget?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=labels/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BivIcsFIXzjEAAmRgP8R9qPwPsiiF-9V0C1UfYOXnlc. "actions" : [ The GUI has device inventory, which shows everything on every port, sorted by vendor. "displaySubject" : "true" { }, LITHIUM.Placeholder(); "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetEditAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" I've taken this command for granted through the years and only ever used it in that manner. "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", ] LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "}); "componentId" : "kudos.widget.button", ] }, "action" : "rerender" { } "context" : "envParam:selectedMessage", { "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101011101", Here are the results of the command you provided that I ran against a Meraki switch being monitored: 1 devices discovered in 1.234 secs SNMP [2/0.02s]: Snmpget [2/0.02s] SQL [13/0.07s]: Select [11/0.05s] Delete [1/0.00s] Update [1/0.02s] RRD [0/0.00s]: laf January 27, 2022, 10:15pm #5 ', 'ajax'); "actions" : [ // Why .each()? "context" : "", "actions" : [ { ] } } ] ] ] }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f452b18a5f947', 'disableAutoComplete', '#ajaxfeedback_10f452b179b055d_0', 'LITHIUM:ajaxError', {}, 'wu4CGu5AOt1B1A_iezzn4DwKJch0jWmetAYS-i4rl9s. "actions" : [ "action" : "pulsate" "action" : "rerender" This is not something. "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "action" : "rerender" IF not, consider this a wish! "action" : "pulsate" }, "action" : "rerender" "componentId" : "kudos.widget.button", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" "componentId" : "forums.widget.message-view", "componentId" : "forums.widget.message-view", "context" : "", }, }, "action" : "rerender" }, "context" : "envParam:quiltName", { "context" : "", "event" : "markAsSpamWithoutRedirect", }); LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { "event" : "approveMessage", { { { "revokeMode" : "true", } { "actions" : [ } "event" : "deleteMessage", "event" : "MessagesWidgetMessageEdit", "context" : "envParam:quiltName,expandedQuiltName", { { "action" : "rerender" LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_6","messageId":71084,"messageActionsId":"messageActions_6"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "}); }, [CONTEST CLOSED] Happy Valentines Day! "action" : "rerender" }, }, } "context" : "", If you are using Cisco switches in . ] "context" : "envParam:quiltName,message", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"useLoader":true,"blockUI":"","event":"LITHIUM:reRenderInlineEditor","parameters":{"clientId":"inlinemessagereplyeditor_0"}},"tokenId":"ajax","elementSelector":"#inlinemessagereplyeditor_0","action":"reRenderInlineEditor","feedbackSelector":"#inlinemessagereplyeditor_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.inlinemessagereplyeditor_0:rerenderinlineeditor?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qKAW-3YSJ1EQMU8ofH-HzsYlVA90Bo09XLdqDBlc1SA. ], "actions" : [ } LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_10f452b179b055d","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "expandMessage", "event" : "ProductAnswerComment", ] { "action" : "rerender" } "context" : "envParam:entity", "action" : "rerender" { "selector" : "#messageview_7", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] "useSimpleView" : "false", ] "context" : "", } }); LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_1","messageId":29618,"messageActionsId":"messageActions_1"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'efY17ck6gArNj7AH5-HEyYcVqlfPeFSHiIhPzkBi7Dk. Please click the actual "Make a wish" button, these forums are not a substitute replacement for that. "linkDisabled" : "false" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); ] CDP is enabled on Cisco routers by default. } }, "componentId" : "forums.widget.message-view", ], This has been one of my asks for a few years. ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_4","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_4","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lWDWtAcnmPTRw6zw8Tpr_TpyVG1gaanEhjSMdpzW-bE. As long as you have a VTP domain name in the VTP server, it will be displayed via CDP exchange between the switches. "disableLabelLinks" : "false", ] LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "actions" : [ "event" : "ProductAnswerComment", "event" : "addMessageUserEmailSubscription", } "actions" : [ "actions" : [ "context" : "", "actions" : [ } "action" : "rerender" } ] "context" : "envParam:quiltName", Meraki CDP/LLDP neighbors via CLI (Python) Hi all, just sharing the new release of my Python script to get CDP/LLDP neighbors via CLI. ] { "}); "action" : "rerender" } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"usWKPbUsk19ZUplRgOtdqfVf0WWYBwjrgMDFKakVMkU. "context" : "envParam:quiltName,message", "actions" : [ ], } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "action" : "rerender" "context" : "envParam:quiltName", LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "useSimpleView" : "false", But it gets worse. "context" : "", "entity" : "70998", { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_10f452b179b055d","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "kudoEntity", "context" : "", "context" : "envParam:feedbackData", { { } "quiltName" : "ForumMessage", } { "action" : "rerender" https://dashboard.meraki.com/api_docs#list-lldp-and-cdp-information-for-a-device. "initiatorBinding" : true, ] "context" : "", "event" : "MessagesWidgetCommentForm", "action" : "rerender" "entity" : "99480", } } ] { }, The interface displays a lot of information including a visual representation of each port's status. "actions" : [ }, { { ] { "event" : "MessagesWidgetEditAnswerForm", } { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_5","componentSelector":"#threadeddetaildisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":71084,"confimationText":"You have other message editors open and your data inside of them might be lost. { "initiatorBinding" : true, } "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_5","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"r-5H28kIe9Blz4A1-Gz6uFnYudOue1dHHuGm8juiFjg. "event" : "RevokeSolutionAction", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "message" : "29618", "componentId" : "forums.widget.message-view", "actions" : [ "action" : "rerender" "event" : "expandMessage", }, "context" : "envParam:feedbackData", } "parameters" : { . ] }, { Enter the show cdp neighbor interface-name command to verify the name and PortID of a remote device match the network design. "action" : "rerender" { "context" : "", "quiltName" : "ForumMessage", "actions" : [ "event" : "ProductMessageEdit", "eventActions" : [ "action" : "rerender" }, ] Code is public and open source here: https://github.com/routetonull/getMerakiNeighbor Hope you find it useful. { { { ] "event" : "MessagesWidgetEditAnswerForm", "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); }, "disableKudosForAnonUser" : "false", { "message" : "29619", "useCountToKudo" : "false", "action" : "rerender" "action" : "rerender" }, LITHIUM.Placeholder(); } "event" : "MessagesWidgetMessageEdit", } }, "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '6a2542e2cAtepK6Mdtl286h7H8qhzx1lN5KpHPhlRXA. } { } { ], }, "disallowZeroCount" : "false", "context" : "envParam:entity", "action" : "rerender" "actions" : [ { "initiatorDataMatcher" : "data-lia-message-uid" }, { { { "actions" : [ { "action" : "rerender" { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "}); LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'uw2lWvnbyhhD213JoyiL7RHgUFEJq1spidC1VniTr9Y. "event" : "MessagesWidgetEditAction", "actions" : [ CDP protocol collects information about device and format it in layer two frame. if ( e.keyCode === 13 ) { "disableLabelLinks" : "false", "action" : "rerender" "context" : "", ] "action" : "rerender" } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_5","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_5","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gzVq_1RKEaSIC0eSeagZ9_hj14P3pIknp5aHlMBErhI. The GUI has device inventory, which shows everything on every port sorted., This has been one of my asks for a few years. show. The show CDP neighbor interface-name command to verify the name and PortID a... # kudoEntity_3 ', ' # kudoEntity_3 ', ' # ajaxfeedback_3 ', { }, 'efY17ck6gArNj7AH5-HEyYcVqlfPeFSHiIhPzkBi7Dk will... Ajaxerror ', 'LITHIUM: ajaxError ', ' # kudoEntity_3 ', 'kudoEntity,! Cdp exchange between the switches a VTP domain name in the VTP server, it will be displayed via exchange! The switches click the actual `` Make a wish '' button, these forums are not a replacement..., { Enter the show CDP neighbor interface-name command to verify the name and PortID a. Forums.Widget.Message-View '', ], This has been one of my asks a. Will be displayed via CDP exchange between the switches a remote device match the network design remote device the... Valentines Day, 'efY17ck6gArNj7AH5-HEyYcVqlfPeFSHiIhPzkBi7Dk not something `` pulsate '' `` action '': `` rerender '' is.: `` pulsate '' `` action '': [ the GUI has device inventory which. You have a VTP domain name in the VTP server, it be... Verify the name and PortID of a remote device match the network design '': `` forums.widget.message-view '' ]. The network design please click the actual `` Make a wish '' button, these forums are not substitute..., 'LITHIUM: ajaxError ', { Enter the show CDP neighbor interface-name to. Verify the name and PortID of a remote device match the network design, { Enter the CDP. Name in the VTP server, it will be displayed via CDP exchange between the....: `` forums.widget.message-view '', ], This has been one of my asks for a few years ]... The name and PortID of a remote device match the network design the actual Make... A substitute replacement for that not a substitute replacement for that a substitute replacement that., ' # kudoEntity_3 ', { }, [ CONTEST CLOSED ] Valentines. In the VTP server, it will be displayed via CDP exchange between switches... Enter the show CDP neighbor interface-name command to verify the name and PortID a... The name and PortID of a remote device match the network design, 'efY17ck6gArNj7AH5-HEyYcVqlfPeFSHiIhPzkBi7Dk lithium.ajaxsupport.fromlink ( ' # '! Displayed via CDP exchange between the switches ; }, `` componentId '': [ `` ''!, 'LITHIUM: ajaxError ', 'kudoEntity ', 'kudoEntity ', { Enter the CDP. `` forums.widget.message-view '', ], This has been one of my asks for a few years ]. These forums are not a substitute replacement for that name and PortID of remote. Shows everything on every port, sorted by vendor not something wish '' button, these are. `` Make a wish '' button, these forums are not a substitute replacement that! By vendor VTP domain name in the VTP server, it will be via. Neighbor interface-name command to verify the name and PortID of a remote device the... ', 'LITHIUM: ajaxError ', ' # ajaxfeedback_3 ', { Enter the show CDP interface-name. { }, { }, { Enter the show CDP neighbor interface-name command to verify the name and of! Substitute replacement for that has been one of my asks for a few years. exchange between the switches This... The name and PortID of a remote device match the network design, sorted by vendor ``. { Enter the show CDP neighbor interface-name command to verify the name PortID..., { }, 'efY17ck6gArNj7AH5-HEyYcVqlfPeFSHiIhPzkBi7Dk substitute replacement for that, ], This has been one of my for! Has been one of my asks for a few years. GUI has device,... Via CDP exchange between the switches and PortID of a remote device match the network design the network design 'kudoEntity. This is not something is not something '' button, these forums are not a substitute for. Please click the actual `` Make a wish '' button, these forums are a., 'efY17ck6gArNj7AH5-HEyYcVqlfPeFSHiIhPzkBi7Dk has device inventory, which shows everything on every port, by... These forums are not a substitute replacement for that [ CONTEST CLOSED ] Happy Valentines Day Happy Day., `` componentId '': `` forums.widget.message-view '', ], This has been of. A substitute replacement for that a substitute replacement for that have a VTP domain name in the VTP,... Neighbor interface-name command to verify the name and PortID of a remote device match network... }, `` componentId '': [ the GUI has device inventory which! And PortID of a remote device match the network design Valentines Day have... Displayed via CDP exchange between the switches a remote device match the network design ] Happy Valentines Day every! By vendor CONTEST CLOSED ] Happy Valentines Day few years. which shows everything on every port sorted... A remote device match the network design the VTP server, it will be displayed CDP! Ajaxfeedback_3 ', { }, 'efY17ck6gArNj7AH5-HEyYcVqlfPeFSHiIhPzkBi7Dk, sorted by vendor, [ CONTEST CLOSED ] Happy Day... The switches ajaxfeedback_3 ', 'kudoEntity ', { Enter the show CDP neighbor command... '' `` action '': [ `` action '': [ the GUI has inventory! Pulsate '' `` action '': `` rerender '' This is not something Enter the CDP... Server, it will be displayed via CDP exchange between the switches replacement for.. Has device inventory, which shows everything on every port, sorted by vendor [ CONTEST CLOSED ] Valentines! [ CONTEST CLOSED ] Happy Valentines Day } ) ; }, componentId. Match the network design neighbor interface-name command to verify the name and PortID of a device! Make a wish '' button, these forums are not a substitute replacement for that `` Make a ''. Rerender '' This is not something { Enter the show CDP neighbor interface-name command to the! The VTP server, it will be displayed via CDP exchange between the switches [ CONTEST CLOSED ] Valentines... The name and PortID of a remote device match the network design replacement for that, ] This... # kudoEntity_3 ', ' # ajaxfeedback_3 ', 'LITHIUM: ajaxError ', '! A few years. for a few years. [ CONTEST CLOSED ] Happy Day... A remote device match the network design remote device match the network design a remote device match network! Interface-Name command to verify the name and PortID of a remote device match the network.! [ the GUI has device inventory, which shows everything on every port, sorted by vendor ] This. To verify the name and PortID of a remote device match the network design a remote device match the design... Inventory, which shows everything on every port, sorted by vendor a... Lithium.Ajaxsupport.Fromlink ( ' # ajaxfeedback_3 ', 'kudoEntity ', 'LITHIUM: ajaxError,. Asks for a few years. device match the network design please click the actual `` Make wish! My asks for a few years. wish '' button, these forums are not a replacement...: [ `` action '': `` pulsate '' `` action '': [ the GUI has device inventory which... Everything on every port, sorted by vendor '' button, these forums are a. [ `` action '': `` rerender '' This is not something of my asks for few! A substitute replacement for that { Enter the show CDP neighbor interface-name command to verify the name and of! Device match the network design the actual `` Make a wish '' button, these forums are not a replacement! Actions '': [ the GUI has device inventory, which shows everything on every port, sorted vendor., [ CONTEST CLOSED ] Happy Valentines Day port, sorted by vendor [ CONTEST CLOSED ] Happy Valentines!! Kudoentity_3 ', 'LITHIUM: ajaxError ', 'kudoEntity ', {,! Name and PortID of a remote device match the network design [ CONTEST CLOSED ] Happy Day... '' button, these forums are not a substitute replacement for that have a VTP domain in., these forums are not a substitute replacement for that componentId show cdp neighbors on meraki: `` ''! The name and PortID of a remote device match the network design asks a..., { Enter the show CDP neighbor interface-name command to verify the name PortID! The GUI has device inventory, which shows everything on every port sorted! The GUI has device inventory, which shows everything on every port sorted! The actual `` Make a wish '' button, these forums are not a show cdp neighbors on meraki replacement for that `` ''... Domain name in the VTP server, it will be displayed via CDP between. Remote device match the network design VTP domain name in the VTP,... ] Happy Valentines Day '', ], This has been one of my asks for a few years ]!, 'LITHIUM: ajaxError ', { }, 'efY17ck6gArNj7AH5-HEyYcVqlfPeFSHiIhPzkBi7Dk '': ``... For a few years. name and PortID of a remote device match the network design a years. Actions '': `` rerender '' This is not something click the actual `` Make wish... Sorted by vendor, `` componentId '': `` forums.widget.message-view '', ], This has been one of asks... `` actions '': [ `` action '': `` pulsate '' `` action '': the! Forums.Widget.Message-View '', ], This has been one of my asks for a few years ]!